제품 > 항체 > 다중클론항체(pAb)

SRP19 Rabbit pAb (A6752)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using SRP19 Rabbit pAb (A6752) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - SRP19 Rabbit pAb (A6752)

Immunohistochemistry analysis of paraffin-embedded Rat brain using SRP19 Rabbit pAb (A6752) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human vermiform appendix using SRP19 Rabbit pAb (A6752) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Mouse brain using SRP19 Rabbit pAb (A6752) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	SRP19 Rabbit pAb
Catalog No.	A6752
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables 7S RNA binding activity. Contributes to ribosome binding activity. Predicted to be involved in SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition. Located in nucleolus. Part of signal recognition particle, endoplasmic reticulum targeting.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human SRP19 (NP_003126.1).
Sequence	MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK
Gene ID
Swiss Prot
Synonyms	SRP19
Calculated MW	16kDa
Observed MW	16kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HepG2, MCF7
Cellular location	Cytoplasm