제품 > 항체 > 다중클론항체(pAb)

SRPK2 Rabbit pAb (A17536)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using SRPK2 Rabbit pAb (A17536) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 120s.

Overview

Product name	SRPK2 Rabbit pAb
Catalog No.	A17536
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables ATP binding activity; magnesium ion binding activity; and protein serine/threonine kinase activity. Involved in several processes, including nucleic acid metabolic process; peptidyl-serine phosphorylation; and regulation of viral genome replication. Located in chromatin; cytosol; and nuclear lumen.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 420-520 of human SRPK2 (NP_872633.1).
Sequence	NAESDYTYSSSYEQFNGELPNGRHKIPESQFPEFSTSLFSGSLEPVACGSVLSEGSPLTEQEESSPSHDRSRTVSASSTGDLPKAKTRAADLLVNPLDPRN
Gene ID
Swiss Prot
Synonyms	SFRSK2; SRPK2
Calculated MW	78kDa
Observed MW	120kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse heart, Mouse brain, Rat brain
Cellular location	cytoplasm, cytosol, nuclear speck, nucleolus, nucleoplasm, nucleus