제품 > 항체 > 다중클론항체(pAb)

SRPRB Rabbit pAb (A10591)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using SRPRB Rabbit pAb (A10591) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunofluorescence - SRPRB Rabbit pAb (A10591)

Immunofluorescence analysis of H9C2 cells using SRPRB Rabbit pAb (A10591) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of L929 cells using SRPRB Rabbit pAb (A10591) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	SRPRB Rabbit pAb
Catalog No.	A10591
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 57-271 of human SRPRB (NP_067026.3).
Sequence	IRSRRSSQRAVLLVGLCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKIA
Gene ID
Swiss Prot
Synonyms	APMCF1; SR-beta; SRPRB
Calculated MW	30kDa
Observed MW	30kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	MCF7, HT-29, LO2, , B cells, Mouse liver, Mouse pancreas, Mouse small intestine, Rat liver
Cellular location	Endoplasmic reticulum membrane, Single-pass membrane protein