제품 > 항체 > 단일클론항체(mAb)

SRSF1/SF2/ASF Rabbit mAb (A4091)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using SRSF1/SF2/ASF Rabbit mAb (A4091) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - SRSF1/SF2/ASF Rabbit mAb (A4091)

Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using SRSF1/SF2/ASF Rabbit mAb (A4091) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using SRSF1/SF2/ASF Rabbit mAb (A4091) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using SRSF1/SF2/ASF Rabbit mAb (A4091) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using SRSF1/SF2/ASF Rabbit mAb (A4091) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using SRSF1/SF2/ASF Rabbit mAb (A4091) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	SRSF1/SF2/ASF Rabbit mAb
Catalog No.	A4091
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC51453

Background

This gene encodes a member of the arginine/serine-rich splicing factor protein family. The encoded protein can either activate or repress splicing, depending on its phosphorylation state and its interaction partners. Multiple transcript variants have been found for this gene. There is a pseudogene of this gene on chromosome 13.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SRSF1/SF2/ASF (NP_008855.1).
Sequence	GGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSP
Gene ID
Swiss Prot
Synonyms	ASF; SF2; SFRS1; SF2p33; SRp30a; SRSF1/SF2/ASF
Calculated MW	28kDa
Observed MW	33kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:3000 - 1:18000 IHC-P 1:500 - 1:5000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, Hep G2, MCF7, SH-SY5Y, Mouse thymus, Rat thymus
Cellular location	Cytoplasm, Nucleus speckle.
Customer validation	WB(Mus musculus, Homo sapiens)