제품 > 항체 > 단일클론항체(mAb)

SR protein repeat Rabbit mAb (A9377)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using (A9377) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of lysates from Rat liver, using (A9377) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

ABclonal:Immunohistochemistry - SR protein repeat Rabbit mAb (A9377)

Immunohistochemistry analysis of SR protein repeat in paraffin-embedded human colon tissue using SR protein repeat Rabbit mAb (A9377) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of SR protein repeat in paraffin-embedded rat colon tissue using SR protein repeat Rabbit mAb (A9377) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of SR protein repeat in paraffin-embedded human breast tissue using SR protein repeat Rabbit mAb (A9377) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of SR protein repeat in paraffin-embedded human colon carcinoma tissue using SR protein repeat Rabbit mAb (A9377) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunoprecipitation - SR protein repeat Rabbit mAb (A9377)

Immunoprecipitation of SR protein repeat in 600 µg extracts from Mouse thymus using 3 µg SR protein repeat Rabbit mAb (A9377). Western blot analysis was performed using SR protein repeat Rabbit mAb (A9377) at 1:500 dilution.

Overview

Product name	SR protein repeat Rabbit mAb
Catalog No.	A9377
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2754

Background

The protein encoded by this gene is involved in mRNA splicing and may play a role in the determination of alternative splicing. The encoded nuclear protein belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12. Alternative splicing results in multiple transcript variants. In addition, two pseudogenes, one on chromosome 17 and the other on the X chromosome, have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SR protein repeat (Q13247).
Sequence	DKYGPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYSGSRSRSRS
Gene ID
Swiss Prot
Synonyms	B52; SFRS6; SRP55; HEL-S-91; SR protein repeat
Calculated MW	40kDa
Observed MW	55kDa/

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 IHC-P 1:50 - 1:200 IP 0.5μg-4μg antibody for 300μg-600μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	SKOV3, A-431, Mouse testis, Mouse thymus, Rat liver, Mouse thymus
Cellular location	Nucleus, Nucleus speckle