Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | SSPN Rabbit pAb |
---|---|
Catalog No. | A12191 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human SSPN (NP_005077.2). |
---|---|
Sequence | MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQ |
Gene ID | |
Swiss Prot | |
Synonyms | KRAG; NSPN; SPN1; SPN2; DAGA5; SSPN |
Calculated MW | 27kDa |
Observed MW | 27kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | NIH/3T3, Mouse skeletal muscle, Mouse heart, Mouse brain, Rat heart, Rat brain |
Cellular location | Cell junction, Cell membrane, Multi-pass membrane protein, postsynaptic cell membrane, sarcolemma, synapse |
* For research use only. Not for therapeutic or diagnostic purposes.