제품 > 항체 > 단일클론항체(mAb)

ST6GAL1/CD75 Rabbit mAb (A24645)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from Hep G2 cells, using ST6GAL1/CD75 Rabbit mAb (A24645) at 1:7000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - ST6GAL1/CD75 Rabbit mAb (A24645)

Immunohistochemistry analysis of ST6GAL1/CD75 in paraffin-embedded Human liver using ST6GAL1/CD75 Rabbit mAb (A24645) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - ST6GAL1/CD75 Rabbit mAb (A24645)

Confocal imaging of Daudi cells using ST6GAL1/CD75 Rabbit mAb (A24645, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 100x.

ABclonal:Flow CytoMetry - ST6GAL1/CD75 Rabbit mAb (A24645)

Flow cytometry: 1X10^6 HeLa cells (negative control, left) and Daudi cells (right) were surface-stained with ST6GAL1/CD75 Rabbit mAb (A24645, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 Daudi cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, left) or ST6GAL1/CD75 Rabbit mAb (A24645, 2 μg/mL, right).

Overview

Product name	ST6GAL1/CD75 Rabbit mAb
Catalog No.	A24645
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63359

Background

This gene encodes a member of glycosyltransferase family 29. The encoded protein is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein, which is normally found in the Golgi but can be proteolytically processed to a soluble form, is involved in the generation of the cell-surface carbohydrate determinants and differentiation antigens HB-6, CD75, and CD76. This gene has been incorrectly referred to as CD75. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 44-406 of human ST6GAL1/CD75 (NP_001340845.1).
Sequence	EFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
Gene ID
Swiss Prot
Synonyms	ST6N; CDw75; SIAT1; ST6GalI; ST6GAL1/CD75
Calculated MW	20kDa/47kDa
Observed MW	50-70kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:8000 IHC-P 1:500 - 1:1000 IF/ICC 1:50 - 1:200 FC 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Flow Cytometry
Positive samples	Hep G2
Cellular location	Golgi apparatus, golgi stack membrane, secreted

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ST6GAL1/CD75 Rabbit mAb images

Western blot - ST6GAL1/CD75 Rabbit mAb (A24645)

Immunohistochemistry - ST6GAL1/CD75 Rabbit mAb (A24645)

Immunofluorescence - ST6GAL1/CD75 Rabbit mAb (A24645)

Flow CytoMetry - ST6GAL1/CD75 Rabbit mAb (A24645)

Flow cytometry: 1X10^6 Daudi cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, left) or ST6GAL1/CD75 Rabbit mAb (A24645, 2 μg/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.