제품 > 항체 > 단일클론항체(mAb)

STAT4 Rabbit mAb (A4523)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using STAT4 Rabbit mAb (A4523) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - STAT4 Rabbit mAb (A4523)

Immunofluorescence analysis of C6 cells using STAT4 Rabbit mAb (A4523) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH-3T3 cells using STAT4 Rabbit mAb (A4523) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - STAT4 Rabbit mAb (A4523)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg STAT4 antibody (A4523). Western blot was performed from the immunoprecipitate using STAT4 antibody (A4523) at a dilution of 1:1000.

Overview

Product name	STAT4 Rabbit mAb
Catalog No.	A4523
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1071

Background

The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is essential for mediating responses to IL12 in lymphocytes, and regulating the differentiation of T helper cells. Mutations in this gene may be associated with systemic lupus erythematosus and rheumatoid arthritis. Alternate splicing results in multiple transcript variants that encode the same protein.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 649-748 of human STAT4 (NP_003142.1).
Sequence	MAENIPENPLKYLYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPHSPSDLLPMSPSVYAVLRENLSPTTIETAMKSPYSAE
Gene ID
Swiss Prot
Synonyms	SLEB11; STAT4
Calculated MW	86kDa
Observed MW	86kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	HeLa, PC-3, Jurkat
Cellular location	Cytoplasm, Nucleus
Customer validation	WB(Homo sapiens)