Reviews (2)Publications (3) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | STAT6 Rabbit mAb |
---|---|
Catalog No. | A19120 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0481 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 747-847 of human STAT6 (P42226-1). |
---|---|
Sequence | CQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLRANPSW |
Gene ID | |
Swiss Prot | |
Synonyms | STAT6B; STAT6C; D12S1644; IL-4-STAT; STAT6 |
Calculated MW | 94kDa |
Observed MW | 100kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | TE-1, NIH/3T3, Mouse lung |
Cellular location | Cytoplasm, Nucleus. |
Customer validation | (Kidney, liver) IF(Homo sapiens) WB(Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A19120? Please let us know so that we can cite the reference in this datasheet.