제품 > 항체 > 단일클론항체(mAb)

STK33 Rabbit mAb (A19803)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of SH-SY5Y cells, using STK33 Rabbit mAb (A19803) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - STK33 Rabbit mAb (A19803)

Immunofluorescence analysis of NIH/3T3 cells using STK33 Rabbit mAb (A19803) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	STK33 Rabbit mAb
Catalog No.	A19803
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2330

Background

Serine/threonine protein kinase (STK33) is a 524-residue kinase that belongs to the calcium/calmodulin-dependent family of kinases. STK33 exhibits differential expression in normal and malignant cancer tissue, including hepatocellular carcinoma. STK33 expression is required in the context of mutant KRAS, the most commonly mutated human oncogene, to maintain for cellular viability and proliferation. STK33 depletion via modulation of interacting proteins results in proteasome-mediated degradation of STK33 in human cancer cells, triggering apoptosis.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 399-514 of human STK33 (Q9BYT3).
Sequence	KEWKNNPESVEENTTEEKNKPSTEEKLKSYQPWGNVPDANYTSDEEEEKQSTAYEKQFPATSKDNFDMCSSSFTSSKLLPAEIKGEMEKTPVTPSQGTATKYPAKSGALSRTKKKL
Gene ID
Swiss Prot
Synonyms	STK33
Calculated MW	58kDa
Observed MW	65kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	SH-SY5Y
Cellular location	cytoplasm, nucleus, perinuclear region of cytoplasm