제품 > 항체 > 다중클론항체(pAb)

STK38 Rabbit pAb (A8191)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using STK38 Rabbit pAb (A8191) at 1:800 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - STK38 Rabbit pAb (A8191)

Immunofluorescence analysis of U2OS cells using STK38 Rabbit pAb (A8191) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of L929 cells using STK38 Rabbit pAb (A8191) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	STK38 Rabbit pAb
Catalog No.	A8191
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the AGC serine/threonine kinase family of proteins. The kinase activity of this protein is regulated by autophosphorylation and phosphorylation by other upstream kinases. This protein has been shown to function in the cell cycle and apoptosis. This protein has also been found to regulate the protein stability and transcriptional activity of the MYC oncogene. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 366-465 of human STK38 (NP_009202.1).
Sequence	HRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK
Gene ID
Swiss Prot
Synonyms	NDR; NDR1; STK38
Calculated MW	54kDa
Observed MW	54kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	U-937, Rat spleen
Cellular location	Cytoplasm, Nucleus.
Customer validation	WB(Homo sapiens)