제품 > 항체 > 다중클론항체(pAb)

STRA13 Rabbit pAb (A9892)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of extracts of H460 cells, using STRA13 antibody (A9892) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	STRA13 Rabbit pAb
Catalog No.	A9892
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables DNA binding activity. Contributes to double-stranded DNA binding activity. Involved in replication fork processing and resolution of meiotic recombination intermediates. Part of FANCM-MHF complex and Fanconi anaemia nuclear complex.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human STRA13 (NP_659435.2).
Sequence	MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF
Gene ID
Swiss Prot
Synonyms	D9; MHF2; CENP-X; FAAP10; STRA13
Calculated MW	9kDa
Observed MW	14kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	H460
Cellular location	Chromosome, Nucleus, centromere, kinetochore