Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Rat
Product name | STRN4 Rabbit pAb |
---|---|
Catalog No. | A17694 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 230-320 of human STRN4 (NP_037535.2). |
---|---|
Sequence | SGGESLLVKQIEEQIKRNAAGKDGKERLGGSVLGQIPFLQNCEDEDSDEDDELDSVQHKKQRVKLPSKALVPEMEDEDEEDDSEDAINEFD |
Gene ID | |
Swiss Prot | |
Synonyms | ZIN; PPP2R6C; zinedin; STRN4 |
Calculated MW | 81kDa |
Observed MW | 98kDa |
Reactivity | Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Rat lung |
Cellular location | cytoplasm, dendrite, dendritic spine |
* For research use only. Not for therapeutic or diagnostic purposes.