제품 > 항체 > 다중클론항체(pAb)

SUB1 Rabbit pAb (A7070)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using SUB1 Rabbit pAb (A7070) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - SUB1 Rabbit pAb (A7070)

Immunofluorescence analysis of A549 cells using SUB1 Rabbit pAb (A7070).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.

ABclonal:Immunoprecipitation - SUB1 Rabbit pAb (A7070)

Immunoprecipitation analysis of 150 μg extracts of HL60 cells using 3 μg SUB1 antibody (A7070). Western blot was performed from the immunoprecipitate using SUB1 antibody (A7070) at a dilution of 1:500.

Overview

Product name	SUB1 Rabbit pAb
Catalog No.	A7070
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables identical protein binding activity; single-stranded DNA binding activity; and transcription coactivator activity. Involved in negative regulation of DNA metabolic process and regulation of transcription by RNA polymerase II. Located in nucleolus and nucleoplasm. Part of transcription regulator complex.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human SUB1 (NP_006704.3).
Sequence	MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL
Gene ID
Swiss Prot
Synonyms	P15; PC4; p14; SUB1
Calculated MW	14kDa
Observed MW	17kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:100 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	HL-60, BT-474, SW620, Jurkat, Mouse brain
Cellular location	Nucleus
Customer validation	WB(Rattus norvegicus)