제품 > 항체 > 다중클론항체(pAb)

SV2A Rabbit pAb (A17868)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using SV2A Rabbit pAb (A17868) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Overview

Product name	SV2A Rabbit pAb
Catalog No.	A17868
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is one of three related synaptic vesicle proteins. The encoded protein may interact with synaptotagmin to enhance low frequency neurotransmission in quiescent neurons.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 356-447 of human SV2A (NP_055664.3).
Sequence	ESPRFFLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTIHQEDELIEIQSDTGTWYQRWGVRALSLGGQVWGNFLSCFGPEYRRIT
Gene ID
Swiss Prot
Synonyms	SV2; SLC22B1; SV2A
Calculated MW	83kDa
Observed MW	105kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse kidney, Mouse heart, Mouse brain, Rat brain
Cellular location	dendrite, endoplasmic reticulum, GABA-ergic synapse, glutamatergic synapse, neuromuscular junction, neuron projection, plasma membrane, presynaptic active zone, synaptic vesicle, synaptic vesicle membrane
Customer validation	WB(Homo sapiens)