Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | SV2A Rabbit pAb |
---|---|
Catalog No. | A17868 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 356-447 of human SV2A (NP_055664.3). |
---|---|
Sequence | ESPRFFLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTIHQEDELIEIQSDTGTWYQRWGVRALSLGGQVWGNFLSCFGPEYRRIT |
Gene ID | |
Swiss Prot | |
Synonyms | SV2; SLC22B1; SV2A |
Calculated MW | 83kDa |
Observed MW | 105kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse kidney, Mouse heart, Mouse brain, Rat brain |
Cellular location | dendrite, endoplasmic reticulum, GABA-ergic synapse, glutamatergic synapse, neuromuscular junction, neuron projection, plasma membrane, presynaptic active zone, synaptic vesicle, synaptic vesicle membrane |
Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A17868? Please let us know so that we can cite the reference in this datasheet.