제품 > 항체 > 다중클론항체(pAb)

SVOP Rabbit pAb (A15859)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from U-87MG cells, using SVOP Rabbit pAb (A15859) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

Overview

Product name	SVOP Rabbit pAb
Catalog No.	A15859
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable transmembrane transporter activity. Predicted to be involved in transmembrane transport. Predicted to be located in synaptic vesicle.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human SVOP (NP_061181.1).
Sequence	MEEDLFQLRQLPVVKFRRTGESARSEDDTASGEHEVQIEGVHVGLEAVELDDGAAVPKEFANPTDDTFMVEDAVEAIGFG
Gene ID
Swiss Prot
Synonyms	SLC22B4; SVOP
Calculated MW	61kDa
Observed MW	61kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	U-87MG
Cellular location	Cytoplasmic vesicle, Multi-pass membrane protein, secretory vesicle, synaptic vesicle membrane