제품 > 항체 > 다중클론항체(pAb)

SYNJ1 Rabbit pAb (A17581)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of various lysates using SYNJ1 Rabbit pAb (A17581) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	SYNJ1 Rabbit pAb
Catalog No.	A17581
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a phosphoinositide phosphatase that regulates levels of membrane phosphatidylinositol-4, 5-bisphosphate. As such, expression of this enzyme may affect synaptic transmission and membrane trafficking. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SYNJ1 (NP_003886.3).
Sequence	GLLGVLRLNLGDTMLHYLVLVTGCMSVGKIQESEVFRVTSTEFISLRIDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNRFFWN
Gene ID
Swiss Prot
Synonyms	DEE53; EIEE53; INPP5G; PARK20; SYNJ1
Calculated MW	173kDa
Observed MW	140kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Jurkat, Rat brain
Cellular location	clathrin coat of coated pit, cytosol, membrane coat, parallel fiber to Purkinje cell synapse, perinuclear region of cytoplasm, presynapse, synaptic membrane, terminal bouton