Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Secretagogin (SCGN) Rabbit mAb |
---|---|
Catalog No. | A19615 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2196 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 177-276 of human Secretagogin (Secretagogin (SCGN)) (O76038). |
---|---|
Sequence | ILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP |
Gene ID | |
Swiss Prot | |
Synonyms | SEGN; CALBL; SECRET; setagin; DJ501N12.8; Secretagogin (SCGN) |
Calculated MW | 32kDa |
Observed MW | 32kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | Mouse brain, Rat pancreas |
Cellular location | Cytoplasm, Secreted, Cytoplasmic vesicle, secretory vesicle membrane, Nucleus, Cytosol |
Customer validation | IHC(Homo sapiens) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19615? Please let us know so that we can cite the reference in this datasheet.