Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using Secretagogin (Secretagogin (SCGN)) Rabbit mAb (A19615) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human colon using Secretagogin (Secretagogin (SCGN)) Rabbit mAb (A19615) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse stomach using Secretagogin (Secretagogin (SCGN)) Rabbit mAb (A19615) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
| Product name | Secretagogin (SCGN) Rabbit mAb |
|---|---|
| Catalog No. | A19615 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC2196 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 177-276 of human Secretagogin (Secretagogin (SCGN)) (O76038). |
|---|---|
| Sequence | ILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP |
| Gene ID | |
| Swiss Prot | |
| Synonyms | SEGN; CALBL; SECRET; setagin; DJ501N12.8; Secretagogin (SCGN) |
| Calculated MW | 32kDa |
| Observed MW | 32kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | Mouse brain, Rat pancreas |
| Cellular location | Cytoplasm, Secreted, Cytoplasmic vesicle, secretory vesicle membrane, Nucleus, Cytosol |
| Customer validation | IHC(Homo sapiens) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19615? Please let us know so that we can cite the reference in this datasheet.
