Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Septin 2 Rabbit mAb |
---|---|
Catalog No. | A7163 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1810 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 202-298 of human Septin 2 (Q15019). |
---|---|
Sequence | EIEEHNIKIYHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLITHMQDLQEVTQDLHYEN |
Gene ID | |
Swiss Prot | |
Synonyms | DIFF6; NEDD5; SEPT2; NEDD-5; Pnutl3; hNedd5 |
Calculated MW | 41kDa |
Observed MW | 45kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | PC-3, SH-SY5Y, Mouse testis, Mouse brain, Rat brain |
Cellular location | Cell projection, Chromosome, Cleavage furrow, Cytoplasm, Midbody, Cell cortex, Centromere, Cilium membrane, Cytoskeleton, Kinetochore, Spindle |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.