제품 > 항체 > 단일클론항체(mAb)

Septin 2 Rabbit mAb (A7163)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various lysates, using Septin 2 Rabbit mAb (A7163) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	Septin 2 Rabbit mAb
Catalog No.	A7163
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1810

Background

Enables identical protein binding activity. Predicted to be involved in several processes, including cilium assembly; regulation of exocytosis; and smoothened signaling pathway. Predicted to act upstream of or within regulation of L-glutamate import across plasma membrane and regulation of protein localization. Located in several cellular components, including cytoskeleton; photoreceptor connecting cilium; and sperm annulus. Part of septin complex.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 202-298 of human Septin 2 (Q15019).
Sequence	EIEEHNIKIYHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLITHMQDLQEVTQDLHYEN
Gene ID
Swiss Prot
Synonyms	DIFF6; NEDD5; SEPT2; NEDD-5; Pnutl3; hNedd5
Calculated MW	41kDa
Observed MW	45kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	PC-3, SH-SY5Y, Mouse testis, Mouse brain, Rat brain
Cellular location	Cell projection, Chromosome, Cleavage furrow, Cytoplasm, Midbody, Cell cortex, Centromere, Cilium membrane, Cytoskeleton, Kinetochore, Spindle