제품 > 항체 > 다중클론항체(pAb)

Sin3A Rabbit pAb (A1577)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Sin3A Rabbit pAb (A1577) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunofluorescence - Sin3A Rabbit pAb (A1577)

Immunofluorescence analysis of U2OS cells using Sin3A Rabbit pAb (A1577). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - Sin3A Rabbit pAb (A1577)

Immunoprecipitation analysis of 300 μg extracts of Jurkat cells using 3 μg Sin3A antibody (A1577). Western blot was performed from the immunoprecipitate using Sin3A antibody (A1577) at a dilution of 1:1000.

Overview

Product name	Sin3A Rabbit pAb
Catalog No.	A1577
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a transcriptional regulatory protein. It contains paired amphipathic helix (PAH) domains, which are important for protein-protein interactions and may mediate repression by the Mad-Max complex.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-120 of human Sin3A (NP_056292.1).
Sequence	MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQR
Gene ID
Swiss Prot
Synonyms	WITKOS; DEL15Q24; CHR15DELq24; Sin3A
Calculated MW	145kDa
Observed MW	160kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	Jurkat, Mouse lung, Mouse testis, Mouse thymus, Rat testis
Cellular location	Nucleus, nucleolus
Customer validation	WB(Mus musculus, Oryctolagus cuniculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Sin3A Rabbit pAb images

Western blot - Sin3A Rabbit pAb (A1577)

Immunofluorescence - Sin3A Rabbit pAb (A1577)

Immunofluorescence analysis of U2OS cells using Sin3A Rabbit pAb (A1577). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunoprecipitation - Sin3A Rabbit pAb (A1577)

* For research use only. Not for therapeutic or diagnostic purposes.