제품 > 항체 > 다중클론항체(pAb)

Slc31a2 Rabbit pAb (A16362)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of lysates from mouse pancreas, using Slc31a2 Rabbit pAb (A16362) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	Slc31a2 Rabbit pAb
Catalog No.	A16362
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Acts upstream of or within cellular copper ion homeostasis and regulation of copper ion transmembrane transport. Located in late endosome; membrane; and recycling endosome. Is expressed in brain; retina nuclear layer; and urinary system. Orthologous to human SLC31A2 (solute carrier family 31 member 2).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse Slc31a2 (NP_001277447.1).
Sequence	MHFIFSDEAVLLFDFWRVHSPTGMALSVLVVLLLAVLYEGIKVGKAKLLHKTLESLPATNSQQFILGPDQDSTGSRSTSDNRTRLRWFLCYFGQSLVHVI
Gene ID
Swiss Prot
Synonyms	CTR2; Slc31a2
Calculated MW	16kDa
Observed MW	16kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse pancreas
Cellular location	Membrane, Multi-pass membrane protein
Customer validation	WB(Homo sapiens)