Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Arabidopsis thaliana
Product name | SnRK2.3 Rabbit pAb |
---|---|
Catalog No. | A21281 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of arabidopsis thaliana SnRK2.3 (NP_201489.1). |
---|---|
Sequence | DVWSCGVTLYVMLVGAYPFEDPEEPRDYRKTIQRILSVKYSIPDDIRISPECCHLISRIFVADPATRISIPEIKTHSWFLKNLPADLMNESNTGSQFQEPE |
Gene ID | |
Swiss Prot | |
Synonyms | SNRK2-3; SRK2I; SUCROSE NONFERMENTING 1 (SNF1)-RELATED PROTEIN KINASE 2-3; sucrose nonfermenting 1(SNF1)-related protein kinase 2.3; SnRK2.3 |
Calculated MW | 41kDa |
Observed MW | 41kDa |
Reactivity | Arabidopsis thaliana |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Inflorescence |
Cellular location | cytoplasm, nucleus, plastid |
* For research use only. Not for therapeutic or diagnostic purposes.