Review (1)Publications (23) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Snail Rabbit pAb |
---|---|
Catalog No. | A11794 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-267 of human Snail (NP_005976.2). |
---|---|
Sequence | RTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR |
Gene ID | |
Swiss Prot | |
Synonyms | SNA; SNAH; SNAIL; SLUGH2; SNAIL1; dJ710H13.1; Snail |
Calculated MW | 29kDa |
Observed MW | 35kDa/29kDa/35kDa/29kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | 293F transfected with Snail, HeLa, HCT 116, K-562, NIH/3T3, HeLa, HCT 116, NIH/3T3, Mouse lung, Rat lung |
Cellular location | Cytoplasm, Nucleus. |
Customer validation | (mouse cells) WB(Mus musculus, Homo sapiens, Rattus norvegicus) IHC(Homo sapiens,Rattus norvegicus) IHC(Cervus nippon) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A11794? Please let us know so that we can cite the reference in this datasheet.