제품 > 항체 > 단일클론항체(mAb)

Somatostatin (SST) Rabbit mAb (A20617)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Somatostatin (SST) Rabbit mAb (A20617) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human brain tissue using Somatostatin (SST) Rabbit mAb (A20617) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using Somatostatin (SST) Rabbit mAb (A20617) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using Somatostatin (SST) Rabbit mAb (A20617) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using Somatostatin (SST) Rabbit mAb (A20617) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - Somatostatin (SST) Rabbit mAb (A20617)

Confocal imaging of paraffin-embedded Human pancreas tissue using Somatostatin (SST) Rabbit mAb (A20617, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Overview

Product name	Somatostatin (SST) Rabbit mAb
Catalog No.	A20617
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC50670

Background

The hormone somatostatin has active 14 aa and 28 aa forms that are produced by alternate cleavage of the single preproprotein encoded by this gene. Somatostatin is expressed throughout the body and inhibits the release of numerous secondary hormones by binding to high-affinity G-protein-coupled somatostatin receptors. This hormone is an important regulator of the endocrine system through its interactions with pituitary growth hormone, thyroid stimulating hormone, and most hormones of the gastrointestinal tract. Somatostatin also affects rates of neurotransmission in the central nervous system and proliferation of both normal and tumorigenic cells.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 23-116 of human Somatostatin (SST) (NP_001039.1).
Sequence	TGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
Gene ID
Swiss Prot
Synonyms	SMST; SST1; Somatostatin (SST)
Calculated MW	13kDa
Observed MW	Refer to figures

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IHC-P 1:500 - 1:2000 IF/ICC 1:50-1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Immunohistochemistry Immunofluorescence
Positive samples
Cellular location	Secreted.
Customer validation	IF(Mus musculus)