Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Rat
Product name | Sprouty 2 Rabbit mAb |
---|---|
Catalog No. | A8611 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1753 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 216-315 of human Sprouty 2 (O43597). |
---|---|
Sequence | GTCVCCVKGLFYHCSNDDEDNCADNPCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQGCYDRVNRPGCRCKNSNTVCCKVPTVPPRNFEKPT |
Gene ID | |
Swiss Prot | |
Synonyms | IGAN3; hSPRY2; Sprouty 2 |
Calculated MW | 35kDa |
Observed MW | 35kDa |
Reactivity | Human, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | C6 |
Cellular location | Actin cytoskeleton, Cytoskeleton, cytosol, Microtubule cytoskeleton, Nucleus, plasma membrane, Ruffle membrane |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.