Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Syndecan 3 Rabbit mAb |
---|---|
Catalog No. | A20929 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2907 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syndecan 3 (O75056). |
---|---|
Sequence | MKPGPPHRAGAAHGAGAGAGAAAGPGARGLLLPPLLLLLLAGRAAGAQRWRSENFERPVDLEGSGDDDSFPDDELDDLYSGSGSGYFEQESGIETAMRFS |
Gene ID | |
Swiss Prot | |
Synonyms | SDCN; SYND3; Syndecan 3 |
Calculated MW | 45kDa |
Observed MW | 70kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | U-251MG, MCF7, A-549, Mouse lung, Mouse spleen, Rat lung |
Cellular location | cell surface, Golgi lumen, lysosomal lumen, microspike, plasma membrane. |
Customer validation | WB(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A20929? Please let us know so that we can cite the reference in this datasheet.