Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Syntrophin alpha 1 Rabbit mAb |
---|---|
Catalog No. | A19759 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2286 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syntrophin alpha 1 (Q13424). |
---|---|
Sequence | MASGRRAPRTGLLELRAGAGSGAGGERWQRVLLSLAEDVLTVSPADGDPGPEPGAPREQEPAQLNGAAEPGAGPPQLPEALLLQRRRVTVRKADAGGLGI |
Gene ID | |
Swiss Prot | |
Synonyms | SNT1; LQT12; TACIP1; dJ1187J4.5 |
Calculated MW | 54kDa |
Observed MW | 59kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, HepG2, C6, Mouse kidney |
Cellular location | cytoplasm, cytoskeleton, neuromuscular junction, postsynaptic membrane, synapse |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.