제품 > 항체 > 단일클론항체(mAb)

TAK1 Rabbit mAb (A19077)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using TAK1 Rabbit mAb (A19077) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunoprecipitation - TAK1 Rabbit mAb (A19077)

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg TAK1 antibody (A19077). Western blot was performed from the immunoprecipitate using TAK1 antibody (A19077) at a dilution of 1:1000.

Overview

Product name	TAK1 Rabbit mAb
Catalog No.	A19077
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0413

Background

The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase mediates the signaling transduction induced by TGF beta and morphogenetic protein (BMP), and controls a variety of cell functions including transcription regulation and apoptosis. In response to IL-1, this protein forms a kinase complex including TRAF6, MAP3K7P1/TAB1 and MAP3K7P2/TAB2; this complex is required for the activation of nuclear factor kappa B. This kinase can also activate MAPK8/JNK, MAP2K4/MKK4, and thus plays a role in the cell response to environmental stresses. Four alternatively spliced transcript variants encoding distinct isoforms have been reported.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 507-606 of human TAK1 (O43318).
Sequence	LQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKRQGTS
Gene ID
Swiss Prot
Synonyms	CSCF; FMD2; TAK1; MEKK7; TGF1a
Calculated MW	67kDa
Observed MW	75kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	293T, HeLa, A-549, NIH/3T3, Mouse brain
Cellular location	Cell membrane, Cytoplasm, Peripheral membrane protein, endosome
Customer validation	IP(Mus musculus) IF(Mus musculus)