제품 > 항체 > 단일클론항체(mAb)

TAOK1 Rabbit mAb (A21157)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using TAOK1 Rabbit mAb (A21157) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Overview

Product name	TAOK1 Rabbit mAb
Catalog No.	A21157
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC3003

Background

Enables alpha-tubulin binding activity; beta-tubulin binding activity; and kinase activity. Involved in several processes, including mitotic G2 DNA damage checkpoint signaling; negative regulation of microtubule depolymerization; and positive regulation of JNK cascade. Located in microtubule cytoskeleton and perinuclear region of cytoplasm.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 900-985 of human TAOK1 (NP_065842.1).
Sequence	FSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRNSPQALRRTASGGRTEQGMSRS
Gene ID
Swiss Prot
Synonyms	DDIB; PSK2; TAO1; KFC-B; MARKK; PSK-2; hKFC-B; hTAOK1; MAP3K16; TAOK1
Calculated MW	116kDa
Observed MW	116kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Jurkat, U-251 MG, Mouse testis, Rat liver
Cellular location	Cytoplasm, Cytosol, Extracellular exosome, Microtubule cytoskeleton, Perinuclear region of cytoplasm