제품 > 항체 > 다중클론항체(pAb)

TAOK2 Rabbit pAb (A17048)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using TAOK2 Rabbit pAb (A17048) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Overview

Product name	TAOK2 Rabbit pAb
Catalog No.	A17048
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables mitogen-activated protein kinase kinase binding activity; neuropilin binding activity; and protein serine/threonine kinase activity. Involved in several processes, including focal adhesion assembly; intracellular signal transduction; and positive regulation of JNK cascade. Located in cytoplasmic vesicle; cytosol; and nuclear lumen. Part of receptor complex.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 610-730 of human TAOK2 (NP_057235.2).
Sequence	AEWLLRQKEQLQQCQAEEEAGLLRRQRQYFELQCRQYKRKMLLARHSLDQDLLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEYNKRREQELRQ
Gene ID
Swiss Prot
Synonyms	PSK; PSK1; TAO1; TAO2; MAP3K17; Tao2beta; PSK1-BETA; TAOK2
Calculated MW	138kDa
Observed MW	138kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	MCF7, 293T
Cellular location	actin cytoskeleton, axon, axonal growth cone, cytoplasm, cytoplasmic vesicle, cytosol, dendritic growth cone, neuron projection, nucleolus, nucleoplasm