제품 > 항체 > 다중클론항체(pAb)

TCTA Rabbit pAb (A15322)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using TCTA Rabbit pAb (A15322) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Overview

Product name	TCTA Rabbit pAb
Catalog No.	A15322
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Involved in negative regulation of osteoclast differentiation and osteoclast fusion. Predicted to be integral component of membrane.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-103 of human TCTA (NP_071503.1).
Sequence	MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRE
Gene ID
Swiss Prot
Synonyms	TCTA
Calculated MW	11kDa
Observed MW	11kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:200 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T, MCF7, SGC-7901
Cellular location	Membrane, Multi-pass membrane protein