제품 > 항체 > 단일클론항체(mAb)

TCTP/TPT1 Rabbit mAb (A2394)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using TCTP/TPT1 Rabbit mAb (A2394) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - TCTP/TPT1 Rabbit mAb (A2394)

Immunohistochemistry analysis of paraffin-embedded rat brain using TCTP/TPT1 Rabbit mAb (A2394) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunoprecipitation - TCTP/TPT1 Rabbit mAb (A2394)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg TCTP/TPT1 antibody (A2394). Western blot was performed from the immunoprecipitate using TCTP/TPT1 antibody (A2394) at a dilution of 1:1000.

Overview

Product name	TCTP/TPT1 Rabbit mAb
Catalog No.	A2394
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0743

Background

This gene encodes a protein that is a regulator of cellular growth and proliferation. Its mRNA is highly structured and contains an oligopyrimidine tract (5'-TOP) in its 5' untranslated region that functions to repress its translation under quiescent conditions. The encoded protein is involved in a variety of cellular pathways, including apoptosis, protein synthesis and cell division. It binds to and stabilizes microtubules, and removal of this protein through phosphorylation is required for progression through mitotic and meiotic cell divisions. This gene is known to play a role in carcinogenesis, and is upregulated in some cancer cells. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TCTP/TPT1 (P13693).
Sequence	MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIK
Gene ID
Swiss Prot
Synonyms	HRF; p02; p23; TCTP; TCTP/TPT1
Calculated MW	20kDa
Observed MW	23kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	HeLa, HepG2, Mouse liver, Mouse brain, Mouse thymus, Rat liver, Rat ovary, Rat brain
Cellular location	Cytoplasm