제품 > 항체 > 단일클론항체(mAb)

TEAD1/2/3/4 mAb (A5092)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with TEAD2 using TEAD1/2/3/4 mAb(A5092) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 20s.

Western blot analysis of lysates from wild type (WT) and 293F cells transfected with TEAD3 using TEAD1/2/3/4 mAb(A5092) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 10s.

Western blot analysis of various lysates using TEAD1 Rabbit mAb (A5092) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with TEAD1 using TEAD1/2/3/4 mAb(A5092) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 10s.

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with TEAD4 using TEAD1/2/3/4 mAb(A5092) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 10s.

Overview

Product name	TEAD1/2/3/4 mAb
Catalog No.	A5092
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1158

Background

This gene encodes a ubiquitous transcriptional enhancer factor that is a member of the TEA/ATTS domain family. This protein directs the transactivation of a wide variety of genes and, in placental cells, also acts as a transcriptional repressor. Mutations in this gene cause Sveinsson's chorioretinal atrophy. Additional transcript variants have been described but their full-length natures have not been experimentally verified.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 174-263 of human TEAD4 (NP_003204.2)
Sequence	SHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLE
Gene ID
Swiss Prot
Synonyms	AA; REF1; TCF13; TEF-1; NTEF-1; TCF-13; TEAD-1
Calculated MW	48, 48, 49, 47kDa
Observed MW	50, 53, 55, 60kDa/70-90kDa/70-90kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293T, BxPC-3, 293F, 293T, 293T
Cellular location	Nucleus