제품 > 항체 > 다중클론항체(pAb)

TEAD3 Rabbit pAb (A7454)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using TEAD3 Rabbit pAb (A7454) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - TEAD3 Rabbit pAb (A7454)

Immunohistochemistry analysis of paraffin-embedded Human placenta using TEAD3 Rabbit pAb (A7454) at dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - TEAD3 Rabbit pAb (A7454)

Immunofluorescence analysis of A549 cells using TEAD3 Rabbit pAb (A7454).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.

Confocal immunofluorescence analysis of U-2 OS cells using TEAD3 Rabbit pAb (A7454) at dilution of 1:400. Blue: DAPI for nuclear staining.

Overview

Product name	TEAD3 Rabbit pAb
Catalog No.	A7454
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is predominantly expressed in the placenta and is involved in the transactivation of the chorionic somatomammotropin-B gene enhancer. Translation of this protein is initiated at a non-AUG (AUA) start codon.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 130-330 of human TEAD3 (NP_003205.2).
Sequence	SSAQIVSASVLQNKFSPPSPLPQAVFSTSSRFWSSPPLLGQQPGPSQDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAASVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWADLNSTIQEGPGAFYGVSSQYSSADSMTIS
Gene ID
Swiss Prot
Synonyms	TEF5; TEAD5; TEF-5; DTEF-1; ETFR-1; TEAD-3; TEAD3
Calculated MW	49kDa
Observed MW	49kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Mouse heart, Mouse lung, Rat heart
Cellular location	Nucleus
Customer validation	Co-IP(Homo sapiens) WB(Mus musculus, Homo sapiens) IF(Mus musculus) ChIP(Mus musculus) IP(Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TEAD3 Rabbit pAb images

Western blot - TEAD3 Rabbit pAb (A7454)

Immunohistochemistry - TEAD3 Rabbit pAb (A7454)

Immunofluorescence - TEAD3 Rabbit pAb (A7454)

Immunofluorescence analysis of A549 cells using TEAD3 Rabbit pAb (A7454).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.

Immunofluorescence - TEAD3 Rabbit pAb (A7454)

Confocal immunofluorescence analysis of U-2 OS cells using TEAD3 Rabbit pAb (A7454) at dilution of 1:400. Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.