제품 > 항체 > 단일클론항체(mAb)

TET1 Rabbit mAb (A21914)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from ESCS cells using TET1 Rabbit mAb (A21914) at1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - TET1 Rabbit mAb (A21914)

Immunohistochemistry analysis of paraffin-embedded Human testis using TET1 Rabbit mAb (A21914) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse testis using TET1 Rabbit mAb (A21914) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Overview

Product name	TET1 Rabbit mAb
Catalog No.	A21914
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC51468

Background

Enables methylcytosine dioxygenase activity. Involved in several processes, including dendrite morphogenesis; inner cell mass cell differentiation; and protein O-linked glycosylation. Acts upstream of or within DNA demethylation; regulation of DNA methylation; and regulation of genetic imprinting. Located in nucleus. Is expressed in several structures, including brain; early conceptus; embryo ectoderm; lower urogenital tract; and reproductive system. Orthologous to human TET1 (tet methylcytosine dioxygenase 1).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1749-1902 of mouse TET1 (NP_001240786.1).
Sequence	HNTKSFSSASSTSHLVKDESTDFCPLQASSAETSTCTYSKTASGGFAETSSILHCTMPSGAHSGANAAAGECTGTVQPAEVAAHPHQSLPTADSPVHAEPLTSPSEQLTSNQSNQQLPLLSNSQKLASCQVEDERHPEADEPQHPEDDNLPQLD
Gene ID
Swiss Prot
Synonyms	LCX; Cxxc6; mKIAA1676; D10Ertd17e; 2510010B09Rik; TET1
Calculated MW	219kDa
Observed MW	260kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	ESCS
Cellular location	nucleoplasm, nucleus.