제품 > 항체 > 다중클론항체(pAb)

TET1 Rabbit pAb (A20427)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Immunohistochemistry analysis of paraffin-embedded human testis using TET1 Rabbit pAb (A20427) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse embryos using TET1 Rabbit pAb (A20427) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Overview

Product name	TET1 Rabbit pAb
Catalog No.	A20427
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables methylcytosine dioxygenase activity. Involved in several processes, including dendrite morphogenesis; inner cell mass cell differentiation; and protein O-linked glycosylation. Acts upstream of or within DNA demethylation; regulation of DNA methylation; and regulation of genetic imprinting. Located in nucleus. Is expressed in several structures, including brain; early conceptus; embryo ectoderm; lower urogenital tract; and reproductive system. Orthologous to human TET1 (tet methylcytosine dioxygenase 1).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1749-1902 of mouse TET1 (NP_001240786.1).
Sequence	HNTKSFSSASSTSHLVKDESTDFCPLQASSAETSTCTYSKTASGGFAETSSILHCTMPSGAHSGANAAAGECTGTVQPAEVAAHPHQSLPTADSPVHAEPLTSPSEQLTSNQSNQQLPLLSNSQKLASCQVEDERHPEADEPQHPEDDNLPQLD
Gene ID
Swiss Prot
Synonyms	LCX; Cxxc6; mKIAA1676; D10Ertd17e; 2510010B09Rik; TET1
Calculated MW	219kDa
Observed MW	250kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse testis, Rat heart
Cellular location	nucleoplasm, nucleus