Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | TFEB Rabbit pAb |
---|---|
Catalog No. | A21657 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 391-461 of human TFEB (NP_009093.1). |
---|---|
Sequence | FHHLDFSHSLSFGGREDEGPPGYPEPLAPGHGSPFPSLSKKDLDLMLLDDSLLPLASDPLLSTMSPEASKA |
Gene ID | |
Swiss Prot | |
Synonyms | TCFEB; BHLHE35; ALPHATFEB; TFEB |
Calculated MW | 52kDa |
Observed MW | 65-70kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Mouse liver, Mouse heart |
Cellular location | cytoplasm, cytosol, extracellular exosome, microtubule cytoskeleton, mitochondrial inner membrane, mitochondrial intermembrane space, mitochondrial matrix, mitochondrial nucleoid, mitochondrion, nucleus. |
Customer validation | RIP(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A21657? Please let us know so that we can cite the reference in this datasheet.