제품 > 항체 > 단일클론항체(mAb)

TFF1/pS2 Rabbit mAb (A22999)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using TFF1/pS2 Rabbit mAb (A22999) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

ABclonal:Immunofluorescence - TFF1/pS2 Rabbit mAb (A22999)

Immunofluorescence analysis of paraffin-embedded mouse spleen using TFF1/pS2 Rabbit mAb (A22999) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunofluorescence analysis of paraffin-embedded rat stomach using TFF1/pS2 Rabbit mAb (A22999) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

ABclonal:Immunoprecipitation - TFF1/pS2 Rabbit mAb (A22999)

Immunoprecipitation analysis of 300 μg extracts of MCF7 cells using 3 μg TFF1/pS2 antibody (A22999). Western blot was performed from the immunoprecipitate using TFF1/pS2 antibody (A22999) at a dilution of 1:1000.

Overview

Product name	TFF1/pS2 Rabbit mAb
Catalog No.	A22999
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC59782

Background

Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer, and affect healing of the epithelium. This gene, which is expressed in the gastric mucosa, has also been studied because of its expression in human tumors. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 25-84 of human TFF1/pS2. (NP_003216.1).
Sequence	EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
Gene ID
Swiss Prot
Synonyms	pS2; BCEI; HPS2; HP1.A; pNR-2; D21S21; TFF1/pS2
Calculated MW	9kDa
Observed MW	13kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	MCF7, Mouse stomach, Rat stomach
Cellular location	extracellular region, extracellular space