TFF3 Rabbit pAb (A1978)

Publications (1) Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

ABclonal:Immunofluorescence - TFF3 Rabbit pAb (A1978)

Immunofluorescence analysis of human colon carcinoma using TFF3 Rabbit pAb (A1978) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	TFF3 Rabbit pAb
Catalog No.	A1978
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. This gene is expressed in goblet cells of the intestines and colon. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 22-94 of human TFF3 (NP_003217.3).
Sequence	MLGLVLALLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
Gene ID
Swiss Prot
Synonyms	ITF; P1B; TFI
Calculated MW	9kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples
Cellular location	Cytoplasm, Secreted, extracellular matrix, extracellular space
Customer validation	WB(Sus scrofa) IHC(Sus scrofa)