Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | TGF beta 1 Rabbit pAb |
---|---|
Catalog No. | A16640 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 291-390 of human TGF beta 1 (NP_000651.3). |
---|---|
Sequence | KNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
Gene ID | |
Swiss Prot | |
Synonyms | CED; LAP; DPD1; TGFB; IBDIMDE; TGFbeta; TGF-beta1; TGF beta 1 |
Calculated MW | 44kDa |
Observed MW | 12kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Mouse spleen |
Cellular location | Secreted, extracellular matrix, extracellular space. |
Customer validation | IHC(A. annua, Mus musculus, Rattus norvegicus) WB(Homo sapiens, Mus musculus, Ovis aries, Rattus norvegicus, Mus musculus) IHC(Rattus norvegicus) IF(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A16640? Please let us know so that we can cite the reference in this datasheet.