제품 > 항체 > 단일클론항체(mAb)

TGN46/TGOLN2 Rabbit mAb (A19618)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from HeLa cells, using TGN46/TGOLN2 Rabbit mAb (A19618) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - TGN46/TGOLN2 Rabbit mAb (A19618)

Immunohistochemistry analysis of paraffin-embedded Human liver using TGN46/TGOLN2 Rabbit mAb (A19618) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - TGN46/TGOLN2 Rabbit mAb (A19618)

Immunofluorescence analysis of U-2 OS cells using TGN46/TGOLN2 Rabbit mAb (A19618) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	TGN46/TGOLN2 Rabbit mAb
Catalog No.	A19618
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2197

Background

This gene encodes a type I integral membrane protein that is localized to the trans-Golgi network, a major sorting station for secretory and membrane proteins. The encoded protein cycles between early endosomes and the trans-Golgi network, and may play a role in exocytic vesicle formation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TGN46/TGOLN2 (O43493).
Sequence	MRFVVALVLLNVAAAGAVPLLATESVKQEEAGVRPSAGNVSTHPSLSQRPGGSTKSHPEPQTPKDSPSKSSAEAQTPEDTPNKSGAEAKTQKDSSNKSGA
Gene ID
Swiss Prot
Synonyms	TGN38; TGN46; TGN48; TGN51; TTGN2; hTGN46; hTGN48; hTGN51; TGN46/TGOLN2
Calculated MW	46kDa
Observed MW	90-100kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:100 - 1:1000 IF/ICC 1:100 - 1:400 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa
Cellular location	endoplasmic reticulum lumen, endosome, Golgi apparatus, nucleoplasm, plasma membrane, trans-Golgi network, trans-Golgi network transport vesicle, transport vesicle.
Customer validation	WB(Homo sapiens) IHC(Homo sapiens)