제품 > 항체 > 다중클론항체(pAb)

TGN46/TGOLN2 Rabbit pAb (A16707)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using TGN46/TGOLN2 Rabbit pAb (A16707) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.

ABclonal:Immunohistochemistry - TGN46/TGOLN2 Rabbit pAb (A16707)

Immunohistochemistry analysis of paraffin-embedded Mouse testis using TGN46/TGN46/TGOLN2 Rabbit pAb (A16707) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse testis using TGN46/TGN46/TGOLN2 Rabbit pAb (A16707) at dilution of 1:100 (20x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon using TGN46/TGN46/TGOLN2 Rabbit pAb (A16707) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Overview

Product name	TGN46/TGOLN2 Rabbit pAb
Catalog No.	A16707
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a type I integral membrane protein that is localized to the trans-Golgi network, a major sorting station for secretory and membrane proteins. The encoded protein cycles between early endosomes and the trans-Golgi network, and may play a role in exocytic vesicle formation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 323-423 of human TGN46/TGN46/TGOLN2 (NP_006455.2).
Sequence	PKEAEDDDTGPEEGSPPKEEKEKMSGSASSENREGTLSDSTGSEKDDLYPNGSGNGSAESSHFFAYLVTAAILVAVLYIAHHNKRKIIAFVLEGKRSKVTR
Gene ID
Swiss Prot
Synonyms	TGN38; TGN46; TGN48; TGN51; TTGN2; hTGN46; hTGN48; hTGN51; TGN46/TGOLN2
Calculated MW	46kDa
Observed MW	110kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	mouse brain, rat brain
Cellular location	Cell membrane, Golgi apparatus, Single-pass type I membrane protein, trans-Golgi network membrane.