Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | TGN46/TGOLN2 Rabbit pAb |
---|---|
Catalog No. | A16707 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 323-423 of human TGN46/TGN46/TGOLN2 (NP_006455.2). |
---|---|
Sequence | PKEAEDDDTGPEEGSPPKEEKEKMSGSASSENREGTLSDSTGSEKDDLYPNGSGNGSAESSHFFAYLVTAAILVAVLYIAHHNKRKIIAFVLEGKRSKVTR |
Gene ID | |
Swiss Prot | |
Synonyms | TGN38; TGN46; TGN48; TGN51; TTGN2; hTGN46; hTGN48; hTGN51; TGN46/TGOLN2 |
Calculated MW | 46kDa |
Observed MW | 110kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | mouse brain, rat brain |
Cellular location | Cell membrane, Golgi apparatus, Single-pass type I membrane protein, trans-Golgi network membrane. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.