제품 > 항체 > 다중클론항체(pAb)

THOC6 Rabbit pAb (A17766)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using THOC6 Rabbit pAb (A17766) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Overview

Product name	THOC6 Rabbit pAb
Catalog No.	A17766
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a subunit of the multi-protein THO complex, which is involved in coordination between transcription and mRNA processing. The THO complex is a component of the TREX (transcription/export) complex, which is involved in transcription and export of mRNAs. A missense mutation in this gene is associated with a neurodevelopmental disorder called Beaulieu-Boycott-Innes syndrome.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of human THOC6 (NP_077315.2).
Sequence	IFSLSSALSSEAKEESKKPVVTFQAHDGPVYSMVSTDRHLLSAGDGEVKAWLWAEMLKKGCKELWRRQPPYRTSLEVPEINALLLVPKENSLILAGGDCQL
Gene ID
Swiss Prot
Synonyms	WDR58; fSAP35; MMRFCGU; THOC6
Calculated MW	38kDa
Observed MW	38kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Raji, HT-29, LO2, Mouse ovary
Cellular location	Nucleus, Nucleus speckle
Customer validation	WB(Homo sapiens)