제품 > 항체 > 다중클론항체(pAb)

THRSP Rabbit pAb (A7232)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with THRSP using THRSP Rabbit pAb (A7232) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - THRSP Rabbit pAb (A7232)

Immunofluorescence analysis of MCF7 cells using THRSP Rabbit pAb (A7232). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	THRSP Rabbit pAb
Catalog No.	A7232
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is similar to the gene product of S14, a rat gene whose expression is limited to liver and adipose tissue and is controlled by nutritional and hormonal factors. This gene has been shown to be expressed in liver and adipocytes, particularly in lipomatous modules. It is also found to be expressed in lipogenic breast cancers, which suggests a role in controlling tumor lipid metabolism.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-146 of human THRSP (NP_003242.1).
Sequence	MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMTGQVW
Gene ID
Swiss Prot
Synonyms	S14; Lpgp; THRP; LPGP1; SPOT14; THRSP
Calculated MW	17kDa
Observed MW	20kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T
Cellular location	Cytoplasm, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구암종양 바이오마커

THRSP Rabbit pAb images

Western blot - THRSP Rabbit pAb (A7232)

Immunofluorescence - THRSP Rabbit pAb (A7232)

Immunofluorescence analysis of MCF7 cells using THRSP Rabbit pAb (A7232). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.