제품 > 항체 > 다중클론항체(pAb)

THUMPD2 Rabbit pAb (A11717)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using THUMPD2 Rabbit pAb (A11717) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	THUMPD2 Rabbit pAb
Catalog No.	A11717
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable tRNA (guanine) methyltransferase activity. Predicted to be involved in tRNA methylation.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 404-503 of human THUMPD2 (NP_079540.2).
Sequence	IVLLLSEDHHRRLTDCKESNIPFNSKDSHTDEPGIKKCLNPEEKTGAFKTASTSFEASNHKFLDRMSPFGSLVPVECYKVSLGKTDAFICKYKKSHSSGL
Gene ID
Swiss Prot
Synonyms	C2orf8; THUMPD2
Calculated MW	56kDa
Observed MW	56kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	A-549, HeLa, HT-29, 293T, Mouse liver, Rat liver
Cellular location