제품 > 항체 > 다중클론항체(pAb)

TIA1 Rabbit pAb (A12523)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of Jurkat, using TIA1 Rabbit pAb (A12523) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - TIA1 Rabbit pAb (A12523)

Immunofluorescence analysis of HepG2 cells using TIA1 Rabbit pAb (A12523) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	TIA1 Rabbit pAb
Catalog No.	A12523
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The product encoded by this gene is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognizes poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15-kDa protein that is thought to be derived from the carboxyl terminus of the 40-kDa product by proteolytic processing. Alternative splicing resulting in different isoforms has been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 287-386 of human TIA1 (NP_071505.2).
Sequence	TLDMINPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ
Gene ID
Swiss Prot
Synonyms	WDM; ALS26; TIA-1
Calculated MW	43kDa
Observed MW	44kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Jurkat
Cellular location	Cytoplasmic granule, Nucleus
Customer validation	IF(Homo sapiens) IP(Homo sapiens)