제품 > 항체 > 다중클론항체(pAb)

TIGAR Rabbit pAb (A20416)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using TIGAR antibody (A20416) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - TIGAR Rabbit pAb (A20416)

Immunofluorescence analysis of NIH/3T3 cells using TIGAR Rabbit pAb (A20416) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using TIGAR Rabbit pAb (A20416) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U2OS cells using TIGAR Rabbit pAb (A20416) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	TIGAR Rabbit pAb
Catalog No.	A20416
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene is regulated as part of the p53 tumor suppressor pathway and encodes a protein with sequence similarity to the bisphosphate domain of the glycolytic enzyme that degrades fructose-2, 6-bisphosphate. The protein functions by blocking glycolysis and directing the pathway into the pentose phosphate shunt. Expression of this protein also protects cells from DNA damaging reactive oxygen species and provides some protection from DNA damage-induced apoptosis. The 12p13.32 region that includes this gene is paralogous to the 11q13.3 region.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TIGAR (NP_065108.1).
Sequence	LSELRAMAKAAREECPVFTPPGGETLDQVKMRGIDFFEFLCQLILKEADQKEQFSQGSPSNCLETSLAEIFPLGKNHSSKVNSDSGIPGLAASVLVVSHGA
Gene ID
Swiss Prot
Synonyms	FR2BP; C12orf5
Calculated MW	30kDa
Observed MW	30kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T, Mouse skeletal muscle, Rat skeletal muscle
Cellular location	cytoplasm, cytosol, mitochondrial outer membrane, nucleus
Customer validation	WB(Mus musculus)