제품 > 항체 > 다중클론항체(pAb)

TIMMDC1 Rabbit pAb (A15839)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using TIMMDC1 Rabbit pAb (A15839) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - TIMMDC1 Rabbit pAb (A15839)

Immunohistochemistry analysis of paraffin-embedded Mouse heart using TIMMDC1 Rabbit pAb (A15839) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Rat heart using TIMMDC1 Rabbit pAb (A15839) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human liver cancer using TIMMDC1 Rabbit pAb (A15839) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	TIMMDC1 Rabbit pAb
Catalog No.	A15839
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Located in mitochondrion and nucleoplasm. Implicated in nuclear type mitochondrial complex I deficiency 31.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 206-285 of human TIMMDC1 (NP_057673.2).
Sequence	LMAFQKYSGETVQERKQKDRKALHELKLEEWKGRLQVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDKD
Gene ID
Swiss Prot
Synonyms	C3orf1; MC1DN31; TIMMDC1
Calculated MW	32kDa
Observed MW	32kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	THP-1, U-937, A-375
Cellular location	Mitochondrion membrane, Multi-pass membrane protein
Customer validation	IHC(Homo sapiens) WB(Homo sapiens)