Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | TIMP3 Rabbit pAb |
---|---|
Catalog No. | A11986 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 110-210 of human TIMP3 (NP_000353.1). |
---|---|
Sequence | DGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATD |
Gene ID | |
Swiss Prot | |
Synonyms | SFD; K222; K222TA2; HSMRK222; TIMP3 |
Calculated MW | 24kDa |
Observed MW | 20kDa/25kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Rat kidney |
Cellular location | Secreted, extracellular matrix, extracellular space. |
Customer validation | IHC(Gallus gallus) WB(Mus musculus, Rattus norvegicus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11986? Please let us know so that we can cite the reference in this datasheet.