Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | TLR2 Rabbit pAb |
---|---|
Catalog No. | A11225 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 600-700 of human TLR2 (NP_003255.2). |
---|---|
Sequence | LLILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTV |
Gene ID | |
Swiss Prot | |
Synonyms | TIL4; CD282; TLR2 |
Calculated MW | 90kDa |
Observed MW | 105kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Rat lung |
Cellular location | Membrane, Single-pass type I membrane protein. |
Customer validation | IF(Rattus norvegicus, Mus musculus) WB(Mus musculus, Sus scrofa, Homo sapiens, Mus musculus, Rattus norvegicus) IHC(Homo sapiens, Rattus norvegicus) IF(Mus musculus) IHC(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11225? Please let us know so that we can cite the reference in this datasheet.